PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_48138
Common NameKK1_045719
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 292aa    MW: 33950.4 Da    PI: 7.8962
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_48138genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.76.5e-092671346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                      WT eE +++  a + + ++   +W ++a++++ g+t ++++  ++ 
    C.cajan_48138 26 EWTSEENKKFESALAIYDKDtpdRWLRVAAMLP-GKTVYDVIKQYRE 71
                     6********************************.********99986 PP

2Myb_DNA-binding42.71.3e-13126170347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ +  ++G+g+W+ I+r +  ++t+ q+ s+ qky
    C.cajan_48138 126 PWTEEEHRRFLMGLVKYGKGDWRNISRNFVVTKTPTQVASHAQKY 170
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.6082277IPR017884SANT domain
SMARTSM007171.1E-82375IPR001005SANT/Myb domain
CDDcd001671.77E-62672No hitNo description
PfamPF002491.4E-62671IPR001005SANT/Myb domain
SuperFamilySSF466891.93E-112679IPR009057Homeodomain-like
PROSITE profilePS5129419.678119175IPR017930Myb domain
SuperFamilySSF466892.76E-16120175IPR009057Homeodomain-like
TIGRFAMsTIGR015577.5E-18122174IPR006447Myb domain, plants
SMARTSM007172.7E-11123173IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-11123169IPR009057Homeodomain-like
PfamPF002494.7E-11126170IPR001005SANT/Myb domain
CDDcd001671.33E-8126170No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MEFETPYPTC FMSYSNWFSE KVHCTEWTSE ENKKFESALA IYDKDTPDRW LRVAAMLPGK  60
TVYDVIKQYR ELEEDVTEIE AGRIPVPGYP TSSFTLEMID NQCYDACRKK PATVRSPEQE  120
RKKGVPWTEE EHRRFLMGLV KYGKGDWRNI SRNFVVTKTP TQVASHAQKY YIRQKLSGGK  180
DNKRRPSIHD ITTANLTSDQ ESHMPSEKQK LTTMPKVQIE WINDQNNGSL MVFNPNYDMF  240
MSPSFISSKA LKLKEQDFYD CAFHETYAKL KNPGLTASRD FNKESIFGIH AL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-1727971181RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0312000.0KT031200.1 Glycine max clone HN_CCL_92 MYB/HD-like transcription factor (Glyma11g34930.7) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006601963.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_006601964.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_006601965.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_006601966.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H78e-86DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A151QT260.0A0A151QT26_CAJCA; Myb-like protein J
STRINGGLYMA18G03430.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.12e-90MYB family protein